FOX04
Quantity
Minimum order is: 1 boxShipping
Supplier will ship within 3–10 days of confirmed payment.
Goods will be dispatched from United Kingdom, China port.
Shipping is offered under FOB terms — the supplier covers costs to the named port of shipment.
Sample available · $300.00/sample
Euromart Suppliers order protection
Every payment you make is secured with strict SSL encryption and PCI DSS data protection protocols
Make free local returns for defects on qualifying purchases
Claim a refund if your order doesn't ship, is missing, or arrives with product issues
Meet your supplier
Distributor / Wholesaler • 3 yr • 
UNITED KINGDOM
56%
On-time delivery rate
≤24h
Response Time
75
Employee Size
$500K
Annual Revenue
588
Products Sold
Location
Belfast, United Kingdom
Other recommendations
FOXO4 (Forkhead box O4), specifically in its synthetic research form FOXO4-DRI (D-Retro-Inverso), is a specialized senolytic peptide designed to target and eliminate senescent "zombie" cells by disrupting specific protein-protein interactions.
Key Features & Mechanisms
- Senolytic Activity: Selectively triggers apoptosis (programmed cell death) in senescent cells while leaving healthy cells unharmed.
- p53 Interaction: Disrupts the binding between the FOXO4 protein and the p53 tumor suppressor, allowing p53 to move from the nucleus to the cytoplasm to initiate cell death.
- Retro-Inverso Design: Constructed using D-amino acids in a reversed sequence to mimic the original L-peptide structure while remaining highly resistant to enzymatic degradation (proteolysis).
- Targeted Rejuvenation: Research indicates potential systemic benefits, including improved hair density, restored kidney function, and enhanced physical activity levels in aged models.
Technical Specifications
- Molecular Formula: C228 H370 N78 O62 S2 .
- Molecular Weight: Approximately 5348.2 g/mol.
- Sequence: LTLKEALCAASLILLQHPSRRGQWRRLVCERDREVLGGPLRREDDR (composed of D-amino acids).
- Purity Level: Typically manufactured to a pharmaceutical grade of ≥ 98%.
- Form: Lyophilized (freeze-dried) white powder for maximum stability.
- CAS Number: 2460055-10-9.
Available Configurations & Sourcing
FOXO4-DRI is primarily available through high-end research chemical suppliers in various quantities, qualities and formats:
|
Configuration |
Description |
|
Standard Vials |
Most commonly found in 10 mg or 15 mg single-use glass vials. |
|
Multi-Vial Kits |
Often sold in sets of 2, 5, or 10 vials for extended research protocols. |
|
Lyophilized Cake |
The product is vacuum-sealed as a solid "cake" at the bottom of the vial to ensure integrity during shipping. |
|
Custom Bulk |
Available in larger quantities (grams) for institutional laboratory use upon request. |
Storage & Stability
- Long-term (Powder): Should be stored at -20°C to -80°C for 2–3 years.
- Short-term (Powder): Stable at room temperature for several weeks, but refrigeration is preferred.
- Reconstituted (Liquid): Highly sensitive; must be kept at 4°C and typically used within 7–14 days for optimal potency.
US
GB
