Euromart Suppliers

FOX04

FOX04

FOX04

Store rating:
(0 reviews)
certified
1 - 1000 boxs$150.00

Quantity

Minimum order is: 1 box
box
Subtotal
$150.001 × $150.00

Shipping

Supplier will ship within 3–10 days of confirmed payment.

Goods will be dispatched from United Kingdom, China port.

Shipping is offered under FOB terms — the supplier covers costs to the named port of shipment.

Sample available · $300.00/sample

4 interest-free payments with
KlarnaPayPalAfterpay

Euromart Suppliers order protection

Secure payments
Visa
MC
PayPal

Every payment you make is secured with strict SSL encryption and PCI DSS data protection protocols

Easy Return

Make free local returns for defects on qualifying purchases

Money-back protection

Claim a refund if your order doesn't ship, is missing, or arrives with product issues

Only orders placed and paid through Euromart Suppliers can enjoy free protection by 💰Trade Assurance

Meet your supplier

CorePepts Lab
CorePepts Lab

Distributor / Wholesaler • 3 yr United Kingdom UNITED KINGDOM

56%

On-time delivery rate

≤24h

Response Time

75

Employee Size

$500K

Annual Revenue

588

Products Sold

Location

United KingdomBelfast, United Kingdom

FOXO4 (Forkhead box O4), specifically in its synthetic research form FOXO4-DRI (D-Retro-Inverso), is a specialized senolytic peptide designed to target and eliminate senescent "zombie" cells by disrupting specific protein-protein interactions.

Key Features & Mechanisms

  • Senolytic Activity: Selectively triggers apoptosis (programmed cell death) in senescent cells while leaving healthy cells unharmed.
  • p53 Interaction: Disrupts the binding between the FOXO4 protein and the p53 tumor suppressor, allowing p53 to move from the nucleus to the cytoplasm to initiate cell death.
  • Retro-Inverso Design: Constructed using D-amino acids in a reversed sequence to mimic the original L-peptide structure while remaining highly resistant to enzymatic degradation (proteolysis).
  • Targeted Rejuvenation: Research indicates potential systemic benefits, including improved hair density, restored kidney function, and enhanced physical activity levels in aged models.

Technical Specifications

  • Molecular Formula: C228 H370 N78 O62 S2 .
  • Molecular Weight: Approximately 5348.2 g/mol.
  • Sequence: LTLKEALCAASLILLQHPSRRGQWRRLVCERDREVLGGPLRREDDR (composed of D-amino acids).
  • Purity Level: Typically manufactured to a pharmaceutical grade of ≥ 98%.
  • Form: Lyophilized (freeze-dried) white powder for maximum stability.
  • CAS Number: 2460055-10-9.

Available Configurations & Sourcing

FOXO4-DRI is primarily available through high-end research chemical suppliers in various quantities, qualities and formats:

Configuration

Description

Standard Vials

Most commonly found in 10 mg or 15 mg single-use glass vials.

Multi-Vial Kits

Often sold in sets of 2, 5, or 10 vials for extended research protocols.

Lyophilized Cake

The product is vacuum-sealed as a solid "cake" at the bottom of the vial to ensure integrity during shipping.

Custom Bulk

Available in larger quantities (grams) for institutional laboratory use upon request.

Storage & Stability

  • Long-term (Powder): Should be stored at -20°C to -80°C for 2–3 years.
  • Short-term (Powder): Stable at room temperature for several weeks, but refrigeration is preferred.
  • Reconstituted (Liquid): Highly sensitive; must be kept at 4°C and typically used within 7–14 days for optimal potency.

Ratings & Reviews

Showing all reviews in your chosen language
No reviews yet. Be the first to share your experience with this product.

From Other Suppliers

More from the supplier

Showing 120 of 42 products