FOXO4 (Forkhead box O4), specifically in its synthetic research form FOXO4-DRI (D-Retro-Inverso), is a specialized senolytic peptide designed to target and eliminate senescent "zombie" cells by disrupting specific protein-protein interactions.

Key Features & Mechanisms

• Senolytic Activity: Selectively triggers apoptosis (programmed cell death) in senescent cells while leaving healthy cells unharmed.
• p53 Interaction: Disrupts the binding between the FOXO4 protein and the p53 tumor suppressor, allowing p53 to move from the nucleus to the cytoplasm to initiate cell death.
• Retro-Inverso Design: Constructed using D-amino acids in a reversed sequence to mimic the original L-peptide structure while remaining highly resistant to enzymatic degradation (proteolysis).
• Targeted Rejuvenation: Research indicates potential systemic benefits, including improved hair density, restored kidney function, and enhanced physical activity levels in aged models.

Technical Specifications

• Molecular Formula: C228 H370 N78 O62 S2 .
• Molecular Weight: Approximately 5348.2 g/mol.
• Sequence: LTLKEALCAASLILLQHPSRRGQWRRLVCERDREVLGGPLRREDDR (composed of D-amino acids).
• Purity Level: Typically manufactured to a pharmaceutical grade of ≥ 98%.
• Form: Lyophilized (freeze-dried) white powder for maximum stability.
• CAS Number: 2460055-10-9.

Available Configurations & Sourcing

FOXO4-DRI is primarily available through high-end research chemical suppliers in various quantities, qualities and formats:

Storage & Stability

• Long-term (Powder): Should be stored at -20°C to -80°C for 2–3 years.
• Short-term (Powder): Stable at room temperature for several weeks, but refrigeration is preferred.
• Reconstituted (Liquid): Highly sensitive; must be kept at 4°C and typically used within 7–14 days for optimal potency.