Euromart Suppliers

FOX04

FOX04

FOX04

تقييم المتجر:
(0 مراجعة)
معتمد
1 - 1000 boxs$150.00

الكمية

الحد الأدنى للطلب هو: 1 box
box
المجموع الفرعي
$150.001 × $150.00

الشحن

سيقوم المورّد بالشحن خلال 3–10 أيام من تأكيد الدفع.

سيتم شحن البضائع من United Kingdom, China الميناء.

يتم تقديم الشحن وفق شروط FOB — يتحمّل المورّد التكاليف حتى ميناء الشحن المحدد.

عيّنة متاحة · $300.00/للعيّنة

4 دفعات بدون فوائد مع
KlarnaPayPalAfterpay

Euromart Suppliers حماية الطلب

مدفوعات آمنة
Visa
MC
PayPal

كل دفعة تجريها محمية بتشفير SSL صارم وبروتوكولات حماية بيانات PCI DSS

إرجاع سهل

أجرِ إرجاعًا محليًا مجانيًا للعيوب على المشتريات المؤهّلة

ضمان استرداد الأموال

اطلب استرداد الأموال إذا لم يتم شحن طلبك أو فُقد أو وصل بمشكلات

فقط الطلبات المقدّمة والمدفوعة عبر Euromart Suppliers يمكنها الاستمتاع بالحماية المجانية من 💰Trade Assurance

Meet your supplier

CorePepts L
CorePepts L

Distributor / Wholesaler • 3 yr United Kingdom UNITED KINGDOM

56%

On-time delivery rate

≤24h

Response Time

75

Employee Size

$500K

Annual Revenue

588

Products Sold

Location

United KingdomBelfast, United Kingdom

FOXO4 (Forkhead box O4), specifically in its synthetic research form FOXO4-DRI (D-Retro-Inverso), is a specialized senolytic peptide designed to target and eliminate senescent "zombie" cells by disrupting specific protein-protein interactions.

Key Features & Mechanisms

  • Senolytic Activity: Selectively triggers apoptosis (programmed cell death) in senescent cells while leaving healthy cells unharmed.
  • p53 Interaction: Disrupts the binding between the FOXO4 protein and the p53 tumor suppressor, allowing p53 to move from the nucleus to the cytoplasm to initiate cell death.
  • Retro-Inverso Design: Constructed using D-amino acids in a reversed sequence to mimic the original L-peptide structure while remaining highly resistant to enzymatic degradation (proteolysis).
  • Targeted Rejuvenation: Research indicates potential systemic benefits, including improved hair density, restored kidney function, and enhanced physical activity levels in aged models.

Technical Specifications

  • Molecular Formula: C228 H370 N78 O62 S2 .
  • Molecular Weight: Approximately 5348.2 g/mol.
  • Sequence: LTLKEALCAASLILLQHPSRRGQWRRLVCERDREVLGGPLRREDDR (composed of D-amino acids).
  • Purity Level: Typically manufactured to a pharmaceutical grade of ≥ 98%.
  • Form: Lyophilized (freeze-dried) white powder for maximum stability.
  • CAS Number: 2460055-10-9.

Available Configurations & Sourcing

FOXO4-DRI is primarily available through high-end research chemical suppliers in various quantities, qualities and formats:

Configuration

Description

Standard Vials

Most commonly found in 10 mg or 15 mg single-use glass vials.

Multi-Vial Kits

Often sold in sets of 2, 5, or 10 vials for extended research protocols.

Lyophilized Cake

The product is vacuum-sealed as a solid "cake" at the bottom of the vial to ensure integrity during shipping.

Custom Bulk

Available in larger quantities (grams) for institutional laboratory use upon request.

Storage & Stability

  • Long-term (Powder): Should be stored at -20°C to -80°C for 2–3 years.
  • Short-term (Powder): Stable at room temperature for several weeks, but refrigeration is preferred.
  • Reconstituted (Liquid): Highly sensitive; must be kept at 4°C and typically used within 7–14 days for optimal potency.

Ratings & Reviews

Showing all reviews in your chosen language
No reviews yet. Be the first to share your experience with this product.

From Other Suppliers

More from the supplier