FOX04
Quantidade
O pedido mínimo é: 1 boxFrete
O fornecedor enviará em até 3–10 dias após a confirmação do pagamento.
Os produtos serão despachados de United Kingdom, China o porto.
O frete é oferecido sob termos FOB — o fornecedor cobre os custos até o porto de embarque designado.
Amostra disponível · $300.00/por amostra
Euromart Suppliers proteção do pedido
Cada pagamento é protegido com criptografia SSL rigorosa e protocolos de proteção de dados PCI DSS
Faça devoluções locais gratuitas por defeitos em compras elegíveis
Solicite reembolso se o seu pedido não for enviado, estiver faltando ou chegar com problemas
Meet your supplier
Distributor / Wholesaler • 3 yr • 
UNITED KINGDOM
56%
On-time delivery rate
≤24h
Response Time
75
Employee Size
$500K
Annual Revenue
588
Products Sold
Location
Belfast, United Kingdom
Other recommendations
FOXO4 (Forkhead box O4), specifically in its synthetic research form FOXO4-DRI (D-Retro-Inverso), is a specialized senolytic peptide designed to target and eliminate senescent "zombie" cells by disrupting specific protein-protein interactions.
Key Features & Mechanisms
- Senolytic Activity: Selectively triggers apoptosis (programmed cell death) in senescent cells while leaving healthy cells unharmed.
- p53 Interaction: Disrupts the binding between the FOXO4 protein and the p53 tumor suppressor, allowing p53 to move from the nucleus to the cytoplasm to initiate cell death.
- Retro-Inverso Design: Constructed using D-amino acids in a reversed sequence to mimic the original L-peptide structure while remaining highly resistant to enzymatic degradation (proteolysis).
- Targeted Rejuvenation: Research indicates potential systemic benefits, including improved hair density, restored kidney function, and enhanced physical activity levels in aged models.
Technical Specifications
- Molecular Formula: C228 H370 N78 O62 S2 .
- Molecular Weight: Approximately 5348.2 g/mol.
- Sequence: LTLKEALCAASLILLQHPSRRGQWRRLVCERDREVLGGPLRREDDR (composed of D-amino acids).
- Purity Level: Typically manufactured to a pharmaceutical grade of ≥ 98%.
- Form: Lyophilized (freeze-dried) white powder for maximum stability.
- CAS Number: 2460055-10-9.
Available Configurations & Sourcing
FOXO4-DRI is primarily available through high-end research chemical suppliers in various quantities, qualities and formats:
|
Configuration |
Description |
|
Standard Vials |
Most commonly found in 10 mg or 15 mg single-use glass vials. |
|
Multi-Vial Kits |
Often sold in sets of 2, 5, or 10 vials for extended research protocols. |
|
Lyophilized Cake |
The product is vacuum-sealed as a solid "cake" at the bottom of the vial to ensure integrity during shipping. |
|
Custom Bulk |
Available in larger quantities (grams) for institutional laboratory use upon request. |
Storage & Stability
- Long-term (Powder): Should be stored at -20°C to -80°C for 2–3 years.
- Short-term (Powder): Stable at room temperature for several weeks, but refrigeration is preferred.
- Reconstituted (Liquid): Highly sensitive; must be kept at 4°C and typically used within 7–14 days for optimal potency.
US
GB
